PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.013G124600.3
Common NameB456_013G124600
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB_related
Protein Properties Length: 965aa    MW: 107605 Da    PI: 9.84
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.013G124600.3genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding30.21e-094585345
                        SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
     Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45
                        +W++ E e++++a +++G++ Wk++a+ +  +R+ +++  ++ 
  Gorai.013G124600.3 45 PWSKAEIERFYKAYREYGKD-WKKVAAAVR-NRSTEMVEAFYI 85
                        8*****************99.*********.****99988775 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.72E-104189IPR009057Homeodomain-like
PROSITE profilePS5129311.5724194IPR017884SANT domain
SMARTSM007171.7E-74290IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.8E-64584IPR009057Homeodomain-like
PfamPF002491.6E-84586IPR001005SANT/Myb domain
CDDcd001678.66E-74584No hitNo description
PfamPF065841.5E-33653753IPR033471DIRP domain
SMARTSM011352.8E-57653754IPR033471DIRP domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 965 aa     Download sequence    Send to blast
MAPTRKYKSV NKQYSSKCEV SPDKDAGNSR KSNPKKKLFD KLGPPWSKAE IERFYKAYRE  60
YGKDWKKVAA AVRNRSTEMV EAFYIMNRAY LSLPDGVASV IGLIAMMTDH YSVLGGSDAE  120
IESNEPSKIP RKTQKRKRVK AHFGSSKEDV FLPQSIASTQ GCLSLLKRIG FNGINPHAVG  180
RRTPRVPVSY SYRRDDMENY NPPKKRVKKS EANDNDDEHV AAVTLTGALQ RGSCPQFSQR  240
PYKKAECRRS APVQCYDRML LQSETTKAKL PSSSSKHRIE SRHGGKEPVI GTYIKDTGPT  300
EDMEGAGTVE VREKGKKVYR KKVKAGEFIN NLSDDGGEAC SGIEEGIIDR AVKGKVEMEI  360
SRGKSKLSPW SQRKKSKKIV SGDESASLDA LLALANLSTS ISPASIIESE VSAKFKEDRI  420
ARETDEKPSA SEAASTSHRR DETKHIGPKE KVLNLITEAE DGTSRKSKVG RYSAKDDNVV  480
SEPKQQAEST NNSKKRKSKS FSTSQLQISN PEARMDSPFI QSFDNEDMAE EMNKSLTKGS  540
SAQSSVQSQQ RKSFRVPEDS LTKNDPKFAE TDSLVSTFQV PAESKLVSLP NKHQSRRKMN  600
LKRALLSTDI NSLNYTLANQ PNKDSLSQDG LKERLSFCLS SNLARRWCSF EWFYSAIDYA  660
WFVKKEFVEY LNHVGLGHIP RLTRVEWGVI RSSLGKPRRF SERFLHEERE KLKQYRESVR  720
QHYAQLRIGT TEGLPTDLPQ PLSIGQRVIA IHPETREVND GKVLDLEHDS FKVQFDRPKL  780
GVELVTDIDC MPLNPLENLP ETLGSQNLAF DKFPATPNVS QVNGHSDFRG SGVYAPSGHL  840
ENATSSVNML ANPIKVDASR NVLNAKTSVP SVVAAHQTAN GLPLTMAHIQ GREADIQVMS  900
ELNRALDKKE AILMELRNTN DDILDNKSGG NCLKGSEPFK KHIATVLVQL KEANGQACGF  960
YELM*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1361374RGKSKLSPWSQRKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX5769731e-146JX576973.1 Gossypium hirsutum clone NBRI_GE8704 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012464714.10.0PREDICTED: protein ALWAYS EARLY 2 isoform X1
TrEMBLA0A0D2SCV40.0A0A0D2SCV4_G
STRINGGLYMA10G29481.10.0(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G21430.29e-98DNA binding
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]